| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
| Protein automated matches [190208] (8 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186965] (1 PDB entry) |
| Domain d2b6mb_: 2b6m B: [127996] automated match to d1a23__ complexed with peg; mutant |
PDB Entry: 2b6m (more details), 2.65 Å
SCOPe Domain Sequences for d2b6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6mb_ c.47.1.13 (B:) automated matches {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcahayqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek
Timeline for d2b6mb_: