Lineage for d2b6mb_ (2b6m B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486299Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2486696Protein automated matches [190208] (8 species)
    not a true protein
  7. 2486700Species Escherichia coli [TaxId:562] [186965] (1 PDB entry)
  8. 2486702Domain d2b6mb_: 2b6m B: [127996]
    automated match to d1a23__
    complexed with peg; mutant

Details for d2b6mb_

PDB Entry: 2b6m (more details), 2.65 Å

PDB Description: structure of the dsba mutant (p31a-c33a)
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2b6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6mb_ c.47.1.13 (B:) automated matches {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcahayqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d2b6mb_:

Click to download the PDB-style file with coordinates for d2b6mb_.
(The format of our PDB-style files is described here.)

Timeline for d2b6mb_: