SCOP 1.73: Domain d2b6mb1: 2b6m B:2-188

Lineage for d2b6mb1 (2b6m B:2-188)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.13: DsbA-like [100953] (3 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)

8. Domain d2b6mb1: 2b6m B:2-188 [127996]
   automatically matched to d1ac1a_
   complexed with peg; mutant

Details for d2b6mb1

PDB Entry: 2b6m, 2.65 Å

PDB Description: structure of the dsba mutant (p31a-c33a)

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbA

SCOP Domain Sequences for d2b6mb1:

Sequence; same for both SEQRES and ATOM records:

>d2b6mb1 c.47.1.13 (B:2-188) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
qyedgkqyttlekpvagapqvleffsffcahayqfeevlhisdnvkkklpegvkmtkyhv
nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
vkylsek

Timeline for d2b6mb1:

• d2b6mb1 is new in SCOP 1.73
  
• d2b6mb1 appears in SCOP 1.75
  
• d2b6mb1 appears in the current release, SCOPe 2.08, called d2b6mb_