Lineage for d2b6ha1 (2b6h A:7-180)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695635Protein ADP-ribosylation factor [52614] (14 species)
  7. 695641Species Human (Homo sapiens) [TaxId:9606] [142220] (1 PDB entry)
  8. 695642Domain d2b6ha1: 2b6h A:7-180 [127994]
    complexed with cl, gdp, so4, unx

Details for d2b6ha1

PDB Entry: 2b6h (more details), 1.76 Å

PDB Description: structure of human adp-ribosylation factor 5
PDB Compounds: (A:) ADP-ribosylation factor 5

SCOP Domain Sequences for d2b6ha1:

Sequence, based on SEQRES records: (download)

>d2b6ha1 c.37.1.8 (A:7-180) ADP-ribosylation factor {Human (Homo sapiens) [TaxId: 9606]}
slfsrifgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicftvw
dvggqdkirplwrhyfqntqglifvvdsndrervqesadelqkmlqedelrdavllvfan
kqdmpnampvseltdklglqhlrsrtwyvqatcatqgtglydgldwlshelskr

Sequence, based on observed residues (ATOM records): (download)

>d2b6ha1 c.37.1.8 (A:7-180) ADP-ribosylation factor {Human (Homo sapiens) [TaxId: 9606]}
slfsrifgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicftvw
dvgrplwrhyfqntqglifvvdsndrervqesadelqkmlqedelrdavllvfankqdmp
nampvseltdklglqhlrsrtwyvqatcatqgtglydgldwlshelskr

SCOP Domain Coordinates for d2b6ha1:

Click to download the PDB-style file with coordinates for d2b6ha1.
(The format of our PDB-style files is described here.)

Timeline for d2b6ha1: