Lineage for d2b6ee1 (2b6e E:2-137)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721580Protein Hypothetical protein HI1161 [89905] (1 species)
  7. 721581Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)
  8. 721590Domain d2b6ee1: 2b6e E:2-137 [127990]
    automatically matched to d1o0ia_
    complexed with acy

Details for d2b6ee1

PDB Entry: 2b6e (more details), 1.9 Å

PDB Description: X-Ray Crystal Structure of Protein HI1161 from Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR63.
PDB Compounds: (E:) Hypothetical UPF0152 protein HI1161

SCOP Domain Sequences for d2b6ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6ee1 d.38.1.5 (E:2-137) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvin

SCOP Domain Coordinates for d2b6ee1:

Click to download the PDB-style file with coordinates for d2b6ee1.
(The format of our PDB-style files is described here.)

Timeline for d2b6ee1: