Lineage for d2b6eb2 (2b6e B:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188023Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2188134Protein automated matches [190102] (7 species)
    not a true protein
  7. 2188165Species Haemophilus influenzae [TaxId:727] [186964] (1 PDB entry)
  8. 2188167Domain d2b6eb2: 2b6e B:1-138 [127987]
    Other proteins in same PDB: d2b6eb3, d2b6ec3, d2b6ed3
    automated match to d1o0ia_
    complexed with acy

Details for d2b6eb2

PDB Entry: 2b6e (more details), 1.9 Å

PDB Description: X-Ray Crystal Structure of Protein HI1161 from Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR63.
PDB Compounds: (B:) Hypothetical UPF0152 protein HI1161

SCOPe Domain Sequences for d2b6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6eb2 d.38.1.5 (B:1-138) automated matches {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinl

SCOPe Domain Coordinates for d2b6eb2:

Click to download the PDB-style file with coordinates for d2b6eb2.
(The format of our PDB-style files is described here.)

Timeline for d2b6eb2: