SCOP 1.73: Domain d2b6cb1: 2b6c B:3-215

Lineage for d2b6cb1 (2b6c B:3-215)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (22 families)

5. Family a.118.1.17: BC3264-like [109965] (2 proteins)
   Pfam PF06352; DUF1061
   this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain

6. Protein Hypothetical protein EF3068 [140817] (1 species)
   assigned by a closer overall structural similarity to BC3264; predicted DNA alkylation repair enzyme

7. Species Enterococcus faecalis [TaxId:1351] [140818] (1 PDB entry)

8. Domain d2b6cb1: 2b6c B:3-215 [127984]
   automatically matched to 2B6C A:3-215
   complexed with bme, cl, gol, so4

Details for d2b6cb1

PDB Entry: 2b6c, 2.1 Å

PDB Description: Predicted DNA alkylation repair enzyme from Enterococcus faecalis.

PDB Compounds: (B:) hypothetical protein EF3068

SCOP Domain Sequences for d2b6cb1:

Sequence; same for both SEQRES and ATOM records:

>d2b6cb1 a.118.1.17 (B:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]}
tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
ysktnpqwveelmkelvlsplaqregskylaka

Timeline for d2b6cb1:

• d2b6cb1 is new in SCOP 1.73
  
• d2b6cb1 appears in SCOP 1.75
  
• d2b6cb1 appears in the current release, SCOPe 2.08, called d2b6cb_