![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.17: BC3264-like [109965] (3 proteins) Pfam PF06352; DUF1061 |
![]() | Protein Hypothetical protein EF3068 [140817] (1 species) assigned by a closer overall structural similarity to BC3264; predicted DNA alkylation repair enzyme |
![]() | Species Enterococcus faecalis [TaxId:1351] [140818] (1 PDB entry) Uniprot Q82ZI8 3-215 |
![]() | Domain d2b6cb_: 2b6c B: [127984] automated match to d2b6ca1 complexed with bme, cl, gol, so4 |
PDB Entry: 2b6c (more details), 2.1 Å
SCOPe Domain Sequences for d2b6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6cb_ a.118.1.17 (B:) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq ysktnpqwveelmkelvlsplaqregskylakase
Timeline for d2b6cb_: