SCOPe 2.06: Domain d2b6bd1: 2b6b D:255-382

Lineage for d2b6bd1 (2b6b D:255-382)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69856] (6 PDB entries)
   Uniprot Q9NNX6 253-384

8. Domain d2b6bd1: 2b6b D:255-382 [127982]
   Other proteins in same PDB: d2b6ba1, d2b6ba2, d2b6bb1, d2b6bb2, d2b6bc1, d2b6bc2
   automatically matched to d1k9id_

Details for d2b6bd1

PDB Entry: 2b6b, 25 Å

PDB Description: cryo em structure of dengue complexed with crd of dc-sign

PDB Compounds: (D:) CD209 antigen

SCOPe Domain Sequences for d2b6bd1:

Sequence; same for both SEQRES and ATOM records:

>d2b6bd1 d.169.1.1 (D:255-382) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

Timeline for d2b6bd1:

• d2b6bd1 first appeared in SCOP 1.73
  
• d2b6bd1 appears in SCOPe 2.05
  
• d2b6bd1 appears in SCOPe 2.07
  
• d2b6bd1 appears in the current release, SCOPe 2.08