SCOPe 2.06: Domain d2b6bc1: 2b6b C:298-394

Lineage for d2b6bc1 (2b6b C:298-394)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d2b6bc1: 2b6b C:298-394 [127980]
   Other proteins in same PDB: d2b6ba2, d2b6bb2, d2b6bc2, d2b6bd1
   automatically matched to d1tg8a1

Details for d2b6bc1

PDB Entry: 2b6b, 25 Å

PDB Description: cryo em structure of dengue complexed with crd of dc-sign

PDB Compounds: (C:) Envelope glycoprotein

SCOPe Domain Sequences for d2b6bc1:

Sequence; same for both SEQRES and ATOM records:

>d2b6bc1 b.1.18.4 (C:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d2b6bc1:

• d2b6bc1 first appeared in SCOP 1.73
  
• d2b6bc1 appears in SCOPe 2.05
  
• d2b6bc1 appears in SCOPe 2.07
  
• d2b6bc1 appears in the current release, SCOPe 2.08