![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
![]() | Protein Envelope glycoprotein [49213] (5 species) |
![]() | Species Dengue virus type 2 [TaxId:11060] [89194] (7 PDB entries) |
![]() | Domain d2b6ba1: 2b6b A:298-394 [127976] Other proteins in same PDB: d2b6ba2, d2b6bb2, d2b6bc2, d2b6bd1 automatically matched to d1tg8a1 |
PDB Entry: 2b6b (more details)
SCOP Domain Sequences for d2b6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6ba1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d2b6ba1: