SCOP 1.73: Domain d2b6ab1: 2b6a B:1-427

Lineage for d2b6ab1 (2b6a B:1-427)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (90 PDB entries)

8. Domain d2b6ab1: 2b6a B:1-427 [127975]
   automatically matched to d1bqmb_
   complexed with t50; mutant

Details for d2b6ab1

PDB Entry: 2b6a, 2.65 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50

PDB Compounds: (B:) Reverse transcriptase P51 SUBUNIT

SCOP Domain Sequences for d2b6ab1:

Sequence; same for both SEQRES and ATOM records:

>d2b6ab1 e.8.1.2 (B:1-427) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d2b6ab1:

• d2b6ab1 is new in SCOP 1.73
  
• d2b6ab1 appears in SCOP 1.75
  
• d2b6ab1 appears in the current release, SCOPe 2.08, called d2b6ab_