Lineage for d2b69a1 (2b69 A:4-315)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842862Protein UDP-glucuronate decarboxylase 1 [141880] (1 species)
  7. 2842863Species Human (Homo sapiens) [TaxId:9606] [141881] (1 PDB entry)
    Uniprot Q8NBZ7 87-398
  8. 2842864Domain d2b69a1: 2b69 A:4-315 [127974]
    complexed with nad, udp
    has additional subdomain(s) that are not in the common domain

Details for d2b69a1

PDB Entry: 2b69 (more details), 1.21 Å

PDB Description: Crystal Structure of Human UDP-glucoronic acid decarboxylase
PDB Compounds: (A:) UDP-glucuronate decarboxylase 1

SCOPe Domain Sequences for d2b69a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}
rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
plyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevyg
dpevhpqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmh
mndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpe
ehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnka
ihyfrkeleyqa

SCOPe Domain Coordinates for d2b69a1:

Click to download the PDB-style file with coordinates for d2b69a1.
(The format of our PDB-style files is described here.)

Timeline for d2b69a1: