Lineage for d2b67d1 (2b67 D:1-201)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728985Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 728986Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 728987Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 729004Protein Hypothetical oxidoreductase SP0622 [143608] (1 species)
  7. 729005Species Streptococcus pneumoniae [TaxId:1313] [143609] (1 PDB entry)
  8. 729009Domain d2b67d1: 2b67 D:1-201 [127973]
    automatically matched to 2B67 A:1-201
    complexed with acy, fmn

Details for d2b67d1

PDB Entry: 2b67 (more details), 2.05 Å

PDB Description: crystal structure of the nitroreductase family protein from streptococcus pneumoniae tigr4
PDB Compounds: (D:) COG0778: Nitroreductase

SCOP Domain Sequences for d2b67d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b67d1 d.90.1.1 (D:1-201) Hypothetical oxidoreductase SP0622 {Streptococcus pneumoniae [TaxId: 1313]}
mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl
aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys
eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg
ytdeklepsyrlpvdeiiekr

SCOP Domain Coordinates for d2b67d1:

Click to download the PDB-style file with coordinates for d2b67d1.
(The format of our PDB-style files is described here.)

Timeline for d2b67d1: