![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) ![]() |
![]() | Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins) |
![]() | Protein Hypothetical oxidoreductase SP0622 [143608] (1 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [143609] (1 PDB entry) |
![]() | Domain d2b67d1: 2b67 D:1-201 [127973] automatically matched to 2B67 A:1-201 complexed with acy, fmn |
PDB Entry: 2b67 (more details), 2.05 Å
SCOP Domain Sequences for d2b67d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b67d1 d.90.1.1 (D:1-201) Hypothetical oxidoreductase SP0622 {Streptococcus pneumoniae [TaxId: 1313]} mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg ytdeklepsyrlpvdeiiekr
Timeline for d2b67d1: