SCOP 1.73: Domain d2b67d1: 2b67 D:1-201

Lineage for d2b67d1 (2b67 D:1-201)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)

6. Protein Hypothetical oxidoreductase SP0622 [143608] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143609] (1 PDB entry)

8. Domain d2b67d1: 2b67 D:1-201 [127973]
   automatically matched to 2B67 A:1-201
   complexed with acy, fmn

Details for d2b67d1

PDB Entry: 2b67, 2.05 Å

PDB Description: crystal structure of the nitroreductase family protein from streptococcus pneumoniae tigr4

PDB Compounds: (D:) COG0778: Nitroreductase

SCOP Domain Sequences for d2b67d1:

Sequence; same for both SEQRES and ATOM records:

>d2b67d1 d.90.1.1 (D:1-201) Hypothetical oxidoreductase SP0622 {Streptococcus pneumoniae [TaxId: 1313]}
mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl
aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys
eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg
ytdeklepsyrlpvdeiiekr

Timeline for d2b67d1:

• d2b67d1 is new in SCOP 1.73
  
• d2b67d1 appears in SCOP 1.75
  
• d2b67d1 appears in the current release, SCOPe 2.08, called d2b67d_