Lineage for d2b66x1 (2b66 X:1-78)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891281Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1891282Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1891283Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1891284Protein Ribosomal protein L23 [54191] (4 species)
  7. 1891382Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 1891391Domain d2b66x1: 2b66 X:1-78 [127968]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66y1, d2b66z1

Details for d2b66x1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (X:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2b66x1:

Sequence, based on SEQRES records: (download)

>d2b66x1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Sequence, based on observed residues (ATOM records): (download)

>d2b66x1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
kkavvrlsedddqeva

SCOPe Domain Coordinates for d2b66x1:

Click to download the PDB-style file with coordinates for d2b66x1.
(The format of our PDB-style files is described here.)

Timeline for d2b66x1: