![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries) |
![]() | Domain d2b66x1: 2b66 X:1-78 [127968] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66y1, d2b66z1 automatically matched to d1jj2r_ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66x1:
Sequence, based on SEQRES records: (download)
>d2b66x1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqeva
>d2b66x1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge kkavvrlsedddqeva
Timeline for d2b66x1: