Lineage for d2b66t1 (2b66 T:4-56)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965443Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 1965444Protein Ribosomal protein L24e [57750] (1 species)
  7. 1965445Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1965487Domain d2b66t1: 2b66 T:4-56 [127966]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66t1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2b66t1:

Sequence, based on SEQRES records: (download)

>d2b66t1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records): (download)

>d2b66t1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

SCOPe Domain Coordinates for d2b66t1:

Click to download the PDB-style file with coordinates for d2b66t1.
(The format of our PDB-style files is described here.)

Timeline for d2b66t1: