Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) some topological similarity to ribosomal protein L22 automatically mapped to Pfam PF01196 |
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries) |
Domain d2b66r1: 2b66 R:14-118 [127965] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66r1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]} sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
Timeline for d2b66r1: