![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries) Uniprot Q5SHP8 1-122 |
![]() | Domain d2b66o1: 2b66 O:1-122 [127964] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to d1whi__ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape vi
Timeline for d2b66o1: