Lineage for d2b66i2 (2b66 I:1-55)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208185Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2208186Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2208187Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2208225Species Thermus thermophilus [TaxId:274] [143636] (9 PDB entries)
    Uniprot Q5SLQ1 1-55
  8. 2208232Domain d2b66i2: 2b66 I:1-55 [127960]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66i2

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b66i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66i2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOPe Domain Coordinates for d2b66i2:

Click to download the PDB-style file with coordinates for d2b66i2.
(The format of our PDB-style files is described here.)

Timeline for d2b66i2: