| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) ![]() |
| Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
| Protein Ribosomal protein L9 C-domain [55655] (3 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries) |
| Domain d2b66i1: 2b66 I:56-149 [127959] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to d1div_1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66i1:
Sequence, based on SEQRES records: (download)
>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk
>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk
Timeline for d2b66i1: