![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() automatically mapped to Pfam PF00347 |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries) Uniprot Q72I19 11-81! Uniprot Q72I19 82-170 |
![]() | Domain d2b66h2: 2b66 H:82-170 [127958] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66h2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg elaaniravrppepykgkgiryegelvrl
Timeline for d2b66h2: