![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() |
![]() | Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
![]() | Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
![]() | Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries) Uniprot Q5SHN9 1-208 |
![]() | Domain d2b66f1: 2b66 F:1-246 [127956] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to d1ffkc_ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66f1:
Sequence, based on SEQRES records: (download)
>d2b66f1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]} meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
>d2b66f1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]} meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte salaevaer
Timeline for d2b66f1: