Lineage for d2b64q1 (2b64 Q:2-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668521Protein Ribosomal protein S17 [50304] (2 species)
  7. 668524Species Thermus thermophilus [TaxId:274] [50305] (36 PDB entries)
  8. 668558Domain d2b64q1: 2b64 Q:2-105 [127949]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64r1, d2b64s1, d2b64t1
    automatically matched to d1fjgq_
    complexed with psu, yyg

Details for d2b64q1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d2b64q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64q1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d2b64q1:

Click to download the PDB-style file with coordinates for d2b64q1.
(The format of our PDB-style files is described here.)

Timeline for d2b64q1: