Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (3 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
Domain d2b64p1: 2b64 P:1-83 [127948] Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b64 (more details), 5.9 Å
SCOPe Domain Sequences for d2b64p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b64p1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2b64p1: