Lineage for d2b64o1 (2b64 O:2-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697792Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2697832Domain d2b64o1: 2b64 O:2-89 [127947]
    Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1
    protein/RNA complex
    protein/RNA complex

Details for d2b64o1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2b64o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64o1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2b64o1:

Click to download the PDB-style file with coordinates for d2b64o1.
(The format of our PDB-style files is described here.)

Timeline for d2b64o1: