| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
| Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
| Protein Ribosomal protein S4 [55179] (2 species) also contains a Zn-binding N-terminal subdomain |
| Species Thermus thermophilus [TaxId:274] [55180] (36 PDB entries) |
| Domain d2b64d1: 2b64 D:2-209 [127935] Other proteins in same PDB: d2b64b1, d2b64c1, d2b64c2, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1 automatically matched to d1hnwd_ complexed with psu, yyg |
PDB Entry: 2b64 (more details), 5.9 Å
SCOP Domain Sequences for d2b64d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b64d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr
Timeline for d2b64d1: