Lineage for d2b64b1 (2b64 B:7-240)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840244Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1840245Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1840246Protein Ribosomal protein S2 [52315] (3 species)
  7. 1840283Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 1840328Domain d2b64b1: 2b64 B:7-240 [127932]
    Other proteins in same PDB: d2b64c1, d2b64c2, d2b64d1, d2b64e1, d2b64e2, d2b64f1, d2b64g1, d2b64h1, d2b64i1, d2b64j1, d2b64k1, d2b64l1, d2b64m1, d2b64n1, d2b64o1, d2b64p1, d2b64q1, d2b64r1, d2b64s1, d2b64t1, d2b64u1
    protein/RNA complex
    protein/RNA complex

Details for d2b64b1

PDB Entry: 2b64 (more details), 5.9 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex. This file contains the 30S subunit, tRNAs, mRNA and release factor RF1 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF1 and is described in remark 400.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2b64b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b64b1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d2b64b1:

Click to download the PDB-style file with coordinates for d2b64b1.
(The format of our PDB-style files is described here.)

Timeline for d2b64b1: