SCOP 1.75: Domain d2b63i1: 2b63 I:2-49

Lineage for d2b63i1 (2b63 I:2-49)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d2b63i1: 2b63 I:2-49 [127927]
   Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63j1, d2b63k1, d2b63l1
   automatically matched to d1i3qi1
   complexed with 5bu, mg, zn

Details for d2b63i1

PDB Entry: 2b63, 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2b63i1:

Sequence; same for both SEQRES and ATOM records:

>d2b63i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d2b63i1:

• d2b63i1 first appeared in SCOP 1.73
  
• d2b63i1 appears in SCOPe 2.01
  
• d2b63i1 appears in the current release, SCOPe 2.08