Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
Domain d2b63i1: 2b63 I:2-49 [127927] Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63j1, d2b63k1, d2b63l1 automatically matched to d1i3qi1 complexed with 5bu, mg, zn |
PDB Entry: 2b63 (more details), 3.8 Å
SCOP Domain Sequences for d2b63i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b63i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d2b63i1: