Lineage for d2b63i1 (2b63 I:2-49)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750747Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 750748Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 750749Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 750752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
  8. 750781Domain d2b63i1: 2b63 I:2-49 [127927]
    Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63j1, d2b63k1, d2b63l1
    automatically matched to d1i3qi1
    complexed with 5bu, mg, zn

Details for d2b63i1

PDB Entry: 2b63 (more details), 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2b63i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b63i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d2b63i1:

Click to download the PDB-style file with coordinates for d2b63i1.
(The format of our PDB-style files is described here.)

Timeline for d2b63i1: