Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) |
Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries) |
Domain d2b63g1: 2b63 G:1-79 [127925] Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63e1, d2b63e2, d2b63f1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1 low resulution structure protein/RNA complex; complexed with mg, zn |
PDB Entry: 2b63 (more details), 3.8 Å
SCOPe Domain Sequences for d2b63g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b63g1 i.8.1.1 (G:1-79) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvf
Timeline for d2b63g1: