Lineage for d2b63f1 (2b63 F:72-155)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649980Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 649981Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 650007Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 650008Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 650009Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)
  8. 650024Domain d2b63f1: 2b63 F:72-155 [127924]
    Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1
    automatically matched to d1i3qf_
    complexed with 5bu, mg, zn

Details for d2b63f1

PDB Entry: 2b63 (more details), 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2b63f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b63f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d2b63f1:

Click to download the PDB-style file with coordinates for d2b63f1.
(The format of our PDB-style files is described here.)

Timeline for d2b63f1: