| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (1 protein) |
| Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries) |
| Domain d2b63f1: 2b63 F:72-155 [127924] Other proteins in same PDB: d2b63a1, d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1 automatically matched to d1i3qf_ complexed with 5bu, mg, zn |
PDB Entry: 2b63 (more details), 3.8 Å
SCOP Domain Sequences for d2b63f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b63f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl
Timeline for d2b63f1: