Lineage for d2b63a1 (2b63 A:2-1450)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694889Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 1694890Protein RBP1 [64486] (2 species)
  7. 1694891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 1694909Domain d2b63a1: 2b63 A:2-1450 [127917]
    Other proteins in same PDB: d2b63b1, d2b63c1, d2b63c2, d2b63d1, d2b63e1, d2b63e2, d2b63f1, d2b63g1, d2b63h1, d2b63i1, d2b63i2, d2b63j1, d2b63k1, d2b63l1
    automatically matched to d1i50a_
    protein/RNA complex; complexed with mg, zn

Details for d2b63a1

PDB Entry: 2b63 (more details), 3.8 Å

PDB Description: Complete RNA Polymerase II-RNA inhibitor complex
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2b63a1:

Sequence, based on SEQRES records: (download)

>d2b63a1 e.29.1.2 (A:2-1450) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmideesl

Sequence, based on observed residues (ATOM records): (download)

>d2b63a1 e.29.1.2 (A:2-1450) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkdepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrps
isfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndia
gqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpks
iaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqyg
wkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnl
hvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnm
lywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliid
gqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdt
iadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardka
grlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfsk
ddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledim
vhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtld
psllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqq
tfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatr
rvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgvp
rlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdpr
stvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviws
edndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyv
kepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasd
gsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaeld
dcrgvsenvilgqmapigtgafdvmideesl

SCOPe Domain Coordinates for d2b63a1:

Click to download the PDB-style file with coordinates for d2b63a1.
(The format of our PDB-style files is described here.)

Timeline for d2b63a1: