Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (17 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [188552] (3 PDB entries) |
Domain d2b5ya_: 2b5y A: [127915] automated match to d2b5xa1 |
PDB Entry: 2b5y (more details)
SCOPe Domain Sequences for d2b5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5ya_ c.47.1.10 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt gqlrhfqaggsgmkmlekrvnrvlaete
Timeline for d2b5ya_: