SCOPe 2.08: Domain d2b5ya_: 2b5y A:

Lineage for d2b5ya_ (2b5y A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188552] (3 PDB entries)

8. Domain d2b5ya_: 2b5y A: [127915]
   automated match to d2b5xa1

Details for d2b5ya_

PDB Entry: 2b5y

PDB Description: solution structure of a thioredoxin-like protein in the oxidized form

PDB Compounds: (A:) YkuV protein

SCOPe Domain Sequences for d2b5ya_:

Sequence; same for both SEQRES and ATOM records:

>d2b5ya_ c.47.1.10 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd
qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt
gqlrhfqaggsgmkmlekrvnrvlaete

Timeline for d2b5ya_:

• d2b5ya_ first appeared in SCOP 1.73, called d2b5ya1
  
• d2b5ya_ appears in SCOPe 2.07