Lineage for d2b5xa1 (2b5x A:1-143)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 700025Protein thiol:disulfide oxidoreductase YkuV [142373] (1 species)
  7. 700026Species Bacillus subtilis [TaxId:1423] [142374] (2 PDB entries)
  8. 700027Domain d2b5xa1: 2b5x A:1-143 [127914]

Details for d2b5xa1

PDB Entry: 2b5x (more details)

PDB Description: solution structure of a thioredoxin-like protein in the reduced form
PDB Compounds: (A:) YkuV protein

SCOP Domain Sequences for d2b5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]}
mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd
qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt
gqlrhfqaggsgmkmlekrvnrv

SCOP Domain Coordinates for d2b5xa1:

Click to download the PDB-style file with coordinates for d2b5xa1.
(The format of our PDB-style files is described here.)

Timeline for d2b5xa1: