Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein thiol:disulfide oxidoreductase YkuV [142373] (1 species) |
Species Bacillus subtilis [TaxId:1423] [142374] (2 PDB entries) |
Domain d2b5xa1: 2b5x A:1-143 [127914] |
PDB Entry: 2b5x (more details)
SCOP Domain Sequences for d2b5xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt gqlrhfqaggsgmkmlekrvnrv
Timeline for d2b5xa1: