Lineage for d2b5xa1 (2b5x A:1-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877750Protein thiol:disulfide oxidoreductase YkuV [142373] (1 species)
  7. 2877751Species Bacillus subtilis [TaxId:1423] [142374] (1 PDB entry)
    Uniprot O31699 1-143
  8. 2877752Domain d2b5xa1: 2b5x A:1-143 [127914]

Details for d2b5xa1

PDB Entry: 2b5x (more details)

PDB Description: solution structure of a thioredoxin-like protein in the reduced form
PDB Compounds: (A:) YkuV protein

SCOPe Domain Sequences for d2b5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]}
mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd
qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt
gqlrhfqaggsgmkmlekrvnrv

SCOPe Domain Coordinates for d2b5xa1:

Click to download the PDB-style file with coordinates for d2b5xa1.
(The format of our PDB-style files is described here.)

Timeline for d2b5xa1: