Lineage for d2b5ua2 (2b5u A:84-315)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679416Fold b.110: Cloacin translocation domain [69368] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 679417Superfamily b.110.1: Cloacin translocation domain [69369] (1 family) (S)
  5. 679418Family b.110.1.1: Cloacin translocation domain [69370] (2 proteins)
    Pfam PF03515
  6. 679422Protein Colicin E3 N-terminal domain [69371] (1 species)
  7. 679423Species Escherichia coli [TaxId:562] [69372] (2 PDB entries)
  8. 679424Domain d2b5ua2: 2b5u A:84-315 [127907]
    Other proteins in same PDB: d2b5ua1, d2b5ua3, d2b5ub1, d2b5uc1, d2b5uc3, d2b5ud1
    automatically matched to d1jcha2
    complexed with cit; mutant

Details for d2b5ua2

PDB Entry: 2b5u (more details), 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein
PDB Compounds: (A:) Colicin E3

SCOP Domain Sequences for d2b5ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ua2 b.110.1.1 (A:84-315) Colicin E3 N-terminal domain {Escherichia coli [TaxId: 562]}
vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
mscpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpagftq
ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathp

SCOP Domain Coordinates for d2b5ua2:

Click to download the PDB-style file with coordinates for d2b5ua2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ua2: