SCOPe 2.07: Domain d2b5ua1: 2b5u A:455-551

Lineage for d2b5ua1 (2b5u A:455-551)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily)
   twisted meander beta-sheet of 6 strands

4. Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family)
   automatically mapped to Pfam PF09000

5. Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (2 proteins)

6. Protein Ribonuclease domain of colicin E3 [63842] (1 species)

7. Species Escherichia coli [TaxId:562] [63843] (3 PDB entries)

8. Domain d2b5ua1: 2b5u A:455-551 [127906]
   Other proteins in same PDB: d2b5ua2, d2b5ua3, d2b5ub_, d2b5uc2, d2b5uc3, d2b5ud_
   automatically matched to d1jcha1
   complexed with cit; mutant

Details for d2b5ua1

PDB Entry: 2b5u, 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein

PDB Compounds: (A:) Colicin E3

SCOPe Domain Sequences for d2b5ua1:

Sequence; same for both SEQRES and ATOM records:

>d2b5ua1 b.101.1.1 (A:455-551) Ribonuclease domain of colicin E3 {Escherichia coli [TaxId: 562]}
kgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhg
elegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl

Timeline for d2b5ua1:

• d2b5ua1 first appeared in SCOP 1.73
  
• d2b5ua1 appears in SCOPe 2.06
  
• d2b5ua1 appears in the current release, SCOPe 2.08