Lineage for d2b5ti1 (2b5t I:6-431)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742019Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 742020Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 742021Family e.1.1.1: Serpins [56575] (16 proteins)
  6. 742032Protein Antithrombin [56584] (2 species)
  7. 742036Species Human (Homo sapiens) [TaxId:9606] [56586] (22 PDB entries)
  8. 742037Domain d2b5ti1: 2b5t I:6-431 [127905]
    automatically matched to d1tb6i_
    complexed with bma, fuc, gol, gu0, gu1, gu2, gu3, gu4, gu5, gu6, gu8, gu9, man, nag, ndg, so4; mutant

Details for d2b5ti1

PDB Entry: 2b5t (more details), 2.1 Å

PDB Description: 2.1 angstrom structure of a nonproductive complex between antithrombin, synthetic heparin mimetic sr123781 and two s195a thrombin molecules
PDB Compounds: (I:) antithrombin-III

SCOP Domain Sequences for d2b5ti1:

Sequence, based on SEQRES records: (download)

>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
dictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfyqh
ladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffak
lncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraa
inkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadge
scsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlq
ewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvs
dafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgr
vanpcv

Sequence, based on observed residues (ATOM records): (download)

>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
dictakprdipmnpmciyrspekipeatnrrvwelskansrfattfyqhladskndndni
flsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrkank
asklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnkteg
ritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyqeg
kfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleemml
cvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkaflevn
eegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv

SCOP Domain Coordinates for d2b5ti1:

Click to download the PDB-style file with coordinates for d2b5ti1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ti1: