![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.98: beta-lactamase-inhibitor protein, BLIP [55647] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (1 family) ![]() |
![]() | Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (1 protein) duplication: consists of two clear structural repeats each having this fold |
![]() | Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [55651] (5 PDB entries) |
![]() | Domain d2b5rd1: 2b5r D:1001-1165 [127904] automatically matched to d1jtgb_ mutant |
PDB Entry: 2b5r (more details), 1.65 Å
SCOP Domain Sequences for d2b5rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5rd1 d.98.1.1 (D:1001-1165) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus [TaxId: 1901]} agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp stagvtlslscfdvdgysstgfyrgsahlwftdgvlqgkrqwdlv
Timeline for d2b5rd1: