Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.98: beta-lactamase-inhibitor protein, BLIP [55647] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (1 family) |
Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (1 protein) duplication: consists of two clear structural repeats each having this fold |
Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [55651] (5 PDB entries) |
Domain d2b5rc1: 2b5r C:1001-1165 [127903] automatically matched to d1jtgb_ mutant |
PDB Entry: 2b5r (more details), 1.65 Å
SCOP Domain Sequences for d2b5rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5rc1 d.98.1.1 (C:1001-1165) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus [TaxId: 1901]} agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp stagvtlslscfdvdgysstgfyrgsahlwftdgvlqgkrqwdlv
Timeline for d2b5rc1: