Lineage for d2b5id1 (2b5i D:1-64)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638999Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 2639000Species Human (Homo sapiens) [TaxId:9606] [144118] (5 PDB entries)
    Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85
  8. 2639003Domain d2b5id1: 2b5i D:1-64 [127900]
    Other proteins in same PDB: d2b5ia_, d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2
    complexed with nag

Details for d2b5id1

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (D:) Interleukin-2 receptor alpha chain

SCOPe Domain Sequences for d2b5id1:

Sequence, based on SEQRES records: (download)

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
ctss

Sequence, based on observed residues (ATOM records): (download)

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctsswdnqcqctss

SCOPe Domain Coordinates for d2b5id1:

Click to download the PDB-style file with coordinates for d2b5id1.
(The format of our PDB-style files is described here.)

Timeline for d2b5id1: