SCOP 1.73: Domain d2b5id1: 2b5i D:1-64

Lineage for d2b5id1 (2b5i D:1-64)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Interleukin-2 receptor alpha chain [144117] (1 species)
   consists of two segment-swapped SCR domains

7. Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries)

8. Domain d2b5id1: 2b5i D:1-64 [127900]
   Other proteins in same PDB: d2b5ia1, d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2
   complexed with nag; mutant

Details for d2b5id1

PDB Entry: 2b5i, 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (D:) Interleukin-2 receptor alpha chain

SCOP Domain Sequences for d2b5id1:

Sequence, based on SEQRES records:

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
ctss

Sequence, based on observed residues (ATOM records):

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctsswdnqcqctss

Timeline for d2b5id1:

• d2b5id1 is new in SCOP 1.73
  
• d2b5id1 appears in SCOP 1.75
  
• d2b5id1 appears in the current release, SCOPe 2.08