Lineage for d2b5id1 (2b5i D:1-64)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749505Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 749506Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries)
  8. 749507Domain d2b5id1: 2b5i D:1-64 [127900]
    Other proteins in same PDB: d2b5ia1, d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2
    complexed with nag; mutant

Details for d2b5id1

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (D:) Interleukin-2 receptor alpha chain

SCOP Domain Sequences for d2b5id1:

Sequence, based on SEQRES records: (download)

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
ctss

Sequence, based on observed residues (ATOM records): (download)

>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctsswdnqcqctss

SCOP Domain Coordinates for d2b5id1:

Click to download the PDB-style file with coordinates for d2b5id1.
(The format of our PDB-style files is described here.)

Timeline for d2b5id1: