Lineage for d2b5ic2 (2b5i C:34-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371724Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 2371725Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. 2371729Domain d2b5ic2: 2b5i C:34-129 [127899]
    Other proteins in same PDB: d2b5ia_, d2b5ib1, d2b5ib2, d2b5id1, d2b5id2
    complexed with nag

Details for d2b5ic2

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOPe Domain Sequences for d2b5ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
plpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsgc
qlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

SCOPe Domain Coordinates for d2b5ic2:

Click to download the PDB-style file with coordinates for d2b5ic2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ic2: