SCOPe 2.06: Domain d2b5ic2: 2b5i C:34-129

Lineage for d2b5ic2 (2b5i C:34-129)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor common gamma chain [141041] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141042] (5 PDB entries)
   Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141

8. Domain d2b5ic2: 2b5i C:34-129 [127899]
   Other proteins in same PDB: d2b5ia_, d2b5ib1, d2b5ib2, d2b5id1, d2b5id2
   complexed with nag

Details for d2b5ic2

PDB Entry: 2b5i, 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOPe Domain Sequences for d2b5ic2:

Sequence; same for both SEQRES and ATOM records:

>d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
plpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsgc
qlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

Timeline for d2b5ic2:

• d2b5ic2 first appeared in SCOP 1.73
  
• d2b5ic2 appears in SCOPe 2.05
  
• d2b5ic2 appears in SCOPe 2.07
  
• d2b5ic2 appears in the current release, SCOPe 2.08