SCOP 1.73: Domain d2b5ic2: 2b5i C:34-129

Lineage for d2b5ic2 (2b5i C:34-129)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
Pfam PF00041
Protein Cytokine receptor common gamma chain [141041] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [141042] (2 PDB entries)
Domain d2b5ic2: 2b5i C:34-129 [127899]
Other proteins in same PDB: d2b5ia1, d2b5ib1, d2b5ib2, d2b5id1, d2b5id2
complexed with nag; mutant

Details for d2b5ic2

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOP Domain Sequences for d2b5ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
plpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsgc
qlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

SCOP Domain Coordinates for d2b5ic2:

Click to download the PDB-style file with coordinates for d2b5ic2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ic2: