Lineage for d2b5ic1 (2b5i C:130-224)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657225Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 657226Species Human (Homo sapiens) [TaxId:9606] [141042] (2 PDB entries)
  8. 657227Domain d2b5ic1: 2b5i C:130-224 [127898]
    Other proteins in same PDB: d2b5ia1, d2b5ib1, d2b5ib2, d2b5id1, d2b5id2
    complexed with nag; mutant

Details for d2b5ic1

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOP Domain Sequences for d2b5ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihw

SCOP Domain Coordinates for d2b5ic1:

Click to download the PDB-style file with coordinates for d2b5ic1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ic1: