SCOPe 2.06: Domain d2b5ib2: 2b5i B:104-207

Lineage for d2b5ib2 (2b5i B:104-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interleukin-2 receptor beta chain [141047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
   Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129

8. Domain d2b5ib2: 2b5i B:104-207 [127897]
   Other proteins in same PDB: d2b5ia_, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2
   complexed with nag

Details for d2b5ib2

PDB Entry: 2b5i, 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOPe Domain Sequences for d2b5ib2:

Sequence; same for both SEQRES and ATOM records:

>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkp

Timeline for d2b5ib2:

• d2b5ib2 first appeared in SCOP 1.73
  
• d2b5ib2 appears in SCOPe 2.05
  
• d2b5ib2 appears in SCOPe 2.07
  
• d2b5ib2 appears in the current release, SCOPe 2.08