Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-2 receptor beta chain [141047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
Domain d2b5ib1: 2b5i B:6-103 [127896] Other proteins in same PDB: d2b5ia_, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2 complexed with nag |
PDB Entry: 2b5i (more details), 2.3 Å
SCOPe Domain Sequences for d2b5ib1:
Sequence, based on SEQRES records: (download)
>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen
>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk lttvdivtlrvlcregvrwrvmaiqdfkpfen
Timeline for d2b5ib1: