Lineage for d2b5ib1 (2b5i B:6-103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787752Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 787753Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 787754Domain d2b5ib1: 2b5i B:6-103 [127896]
    Other proteins in same PDB: d2b5ia1, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2
    complexed with nag; mutant

Details for d2b5ib1

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOP Domain Sequences for d2b5ib1:

Sequence, based on SEQRES records: (download)

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Sequence, based on observed residues (ATOM records): (download)

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk
lttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOP Domain Coordinates for d2b5ib1:

Click to download the PDB-style file with coordinates for d2b5ib1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ib1: