SCOP 1.75: Domain d2b5ib1: 2b5i B:6-103

Lineage for d2b5ib1 (2b5i B:6-103)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Interleukin-2 receptor beta chain [141047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries)
   Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129

8. Domain d2b5ib1: 2b5i B:6-103 [127896]
   Other proteins in same PDB: d2b5ia1, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2
   complexed with nag; mutant

Details for d2b5ib1

PDB Entry: 2b5i, 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOP Domain Sequences for d2b5ib1:

Sequence, based on SEQRES records:

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Sequence, based on observed residues (ATOM records):

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk
lttvdivtlrvlcregvrwrvmaiqdfkpfen

Timeline for d2b5ib1:

• d2b5ib1 first appeared in SCOP 1.73
  
• d2b5ib1 appears in SCOPe 2.01
  
• d2b5ib1 appears in the current release, SCOPe 2.08